Borrelia phylostratigraphy table and profiles

Phylostratum (ps) Protein_ID Gene_locus_tag Start End Strand Gene_length Protein_length Gene_name Gene_symbol_gff Protein_sequence Graph_name SP RB BL BF
wdt_ID Phylostratum (ps) Protein_ID Gene_locus_tag Start End Strand Gene_length Protein_length Gene_name Gene_symbol_gff Protein_sequence Graph_name SP RB BL BF
1 6 WP_044283645.1 BB_RS06590 14,343 15,155 + 813 270 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFKGEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSISSATLSRSDDLLIMPSSDTIQKTPVPKHILGVPSNFAYGRTRSTTLYPSDYENNAISINMEYNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPRGLFTRIPIYKGWYVQKRVSLYGDPFPDLLKL DUF685 domain-containing protein _x000D_ BB_RS06590 BB_M22 p = 8.64e-06 -0.262233460 -0.416425734 0.835039472 0.221820045
2 6 WP_012663368.1 BB_RS06160 14,324 15,136 + 813 270 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFKGEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSISSATLSRSDDLLIMPSSDTIQKTPVPKHILGVPSNFAYGRTRSTTLYPSDYENNAISINMEYNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPRGLFTRIPIYKGWYVQKRASLYGDPFPDLLKL DUF685 domain-containing protein _x000D_ BB_RS06160 BB_S22 p = 1.11e-06 -0.445496374 -0.517670028 0.339899452 0.347106102
3 6 WP_010883727.1 BB_RS07005 14,324 15,139 + 816 271 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFKGEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSISSATLSRSDHLLIMPSSDTIQKTPVPKHILGVPSNLAYGSITRSTTLYPSDYENNAIFINMEDNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPRGLFTRIPIYKGWYVQKRASLYGDPVPDLLKL DUF685 domain-containing protein _x000D_ BB_RS07005 BB_L22 p = 8.22e-01 -0.001447609 -5.844685973 -5.844685973 0.001446158
4 6 WP_010883727.1 BB_RS05950 14,324 15,139 + 816 271 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFKGEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSISSATLSRSDHLLIMPSSDTIQKTPVPKHILGVPSNLAYGSITRSTTLYPSDYENNAIFINMEDNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPRGLFTRIPIYKGWYVQKRASLYGDPVPDLLKL DUF685 domain-containing protein _x000D_ BB_RS05950 BB_P22 p = 4.01e-04 -0.350684190 -0.326227115 0.306722768 0.265893319
5 6 WP_010883727.1 BB_RS06795 14,331 15,146 + 816 271 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFKGEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSISSATLSRSDHLLIMPSSDTIQKTPVPKHILGVPSNLAYGSITRSTTLYPSDYENNAIFINMEDNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPRGLFTRIPIYKGWYVQKRASLYGDPVPDLLKL DUF685 domain-containing protein _x000D_ BB_RS06795 BB_O22 p = 9.63e-01 -0.163961619 -0.406435758 0.147214576 0.684968725
6 6 WP_010883915.1 BB_RS07545 17,823 18,638 + 816 271 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDNGAASSNAITFKNFLDASKDKIFKGEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSISSATLSKSDDLLIMPSSDTIQKTPVPKHILGVPSNFTYGSITRSTTLYPSDYENKAISINMEDNDDVTLIFYKNYDNDPIYLDIEIQVKINDNRMQKKSLKLMYSDEITYNWVYEITGPRGLFTRTPIYNGWYIQKRAYMYGDSVPDLLKL DUF685 domain-containing protein _x000D_ BB_RS07545 BB_Q29 p = 1.96e-53 -1.083631934 -0.982809142 1.403554589 0.579186391
7 6 WP_010883778.1 BB_RS06375 14,277 15,092 + 816 271 DUF685 domain-containing protein MADDQEKLLIDEEETVQIKDLNKVTTVNNTDLLLLDDGAASSNAITFKNFLKTVNHQTFKGEELGYFKEIIKSTIATELAADKDFIKSIYDLIVDKLIENESSKLSNLFSKIKSRLTDSISSATLSRSDDLLIMPSSDTIQKTPVPKHILGVPSNFTYGSITRSTTLYPSDYENKAISINMEDNDDVTLIFYKNYDNDPIYLDIEIQVKINDNRMQKKSLKLMYSDEITYNWVYEITGPRGLFTRTPIYNGWYIQKRASLYGDSVPDLLKL DUF685 domain-containing protein _x000D_ BB_RS06375 BB_R22 p = 1.08e-03 -0.271810973 -0.333038720 0.520915999 0.228628869
8 6 WP_010890293.1 BB_RS04580 14,376 14,885 - 510 169 hypothetical protein MADFDFTKLCKNFVLGVEHKACVHQTETAIVDVESPIIKPGDPVYSSGSSEMGEVLVKAATATAGVGPIRGFALKKADIALLESENYSPGELIPIRRAGEITVMLDNTFATPKIGDFVFLKGGKLVKDGKGGVQVGRIKDVSLDANSKVVLLDVNIGPEFESNGNRKFA hypothetical protein _x000D_ BB_RS04580 BB_G18 p = 3.60e-07 -0.113436738 0.105163922 0.768531825 -0.981553544
9 1 WP_002657080.1 BB_RS00560 111,889 112,338 - 450 149 single-stranded DNA-binding protein MADINSLVLSGRLTRDSELSYTESGMAVLRFSIANNRRMKKNDEWIDYPQYFDCVIFSKRAESLNDYLKKGKQVVVSGSLKYESWQDRNTGDKRSKVNIFVDNLQMFSSGSNTIQMQDSDVNSLTNHKKEDVVKDIDIVDDKFSEDIPF single-stranded DNA-binding protein _x000D_ BB_RS00560 BB_0114 p = 2.63e-06 -0.327717440 -0.197778337 0.173904947 0.185789341
10 2 WP_002657824.1 BB_RS01805 375,661 375,939 + 279 92 DNA mismatch repair protein MutT MADLEKINKIKVAEHIVECFGGIKNIKNIDKDLTRIKILVDSNSLVKRDDLTKNDNIIGTIKSNELTEVVINFEIIEDVYNKILYMMNEQKQ DNA mismatch repair protein MutT _x000D_ BB_RS01805 BB_0367 p = 4.24e-30 0.387327574 0.266486606 -0.595556162 -0.327121933

Contact

Domazet-Lošo Research Group

Macroevolution Research. Our lab focuses on macro-evolutionary patterns across the tree of life.
Ruđer Bošković Institute

Division of Molecular Biology
Laboratory of Evolutionary Genetics
wing 5 / rooms 109-111

Biljenička cesta 54
HR-10000 Zagreb
Croatia
linkedin facebook pinterest youtube rss twitter instagram facebook-blank rss-blank linkedin-blank pinterest youtube twitter instagram