Bacillus phylostratigraphy table and profiles

Phylostratum Phylostratum_name Protein_ID_3610 Gene_locus_tag_3610 Start_3610 End_3610 Strand_3610 Gene_length_3610 Protein_length_3610 Gene_name_3610 Gene_symbol_gff_3610 Protein_sequence_3610 Protein_ID_168 Gene_locus_tag_168 Start_168 End_168 Strand_168 Gene_length_168 Protein_length_168 Gene_name_168 Gene_symbol_gff_168 Gene_symbol_SubtiWiki_168 SubtiWiki_categories Gene_symbol_SubtiWiki_synonyms SubtiWiki_operons Graph_name LC 6H 12H 1D 2D 3D 5D 7D 14D 1M 2M
wdt_ID Phylostratum Phylostratum_name Protein_ID_3610 Gene_locus_tag_3610 Start_3610 End_3610 Strand_3610 Gene_length_3610 Protein_length_3610 Gene_name_3610 Gene_symbol_gff_3610 Protein_sequence_3610 Protein_ID_168 Gene_locus_tag_168 Start_168 End_168 Strand_168 Gene_length_168 Protein_length_168 Gene_name_168 Gene_symbol_gff_168 Gene_symbol_SubtiWiki_168 SubtiWiki_categories Gene_symbol_SubtiWiki_synonyms SubtiWiki_operons Graph_name LC 6H 12H 1D 2D 3D 5D 7D 14D 1M 2M
1 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93186.1 B4U62_22290 35,225 35,467 - 243 80 hypothetical protein MNFDDKKSILKTVGNVFMVLVLISLFVYAFSSKSIGWYVKITSIVMLTISYICYALISLQEKWFIATLVVSWLVIIFWVF NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93186.1; B4U62_22290 -0.639502663 1.337309011 0.277145893 1.645840736 0.706908599 0.215969837 0.000000000 -0.534093774 -2.727332048 -1.992233995 -0.890394122
2 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93161.1 B4U62_22145 7,433 7,639 - 207 68 hypothetical protein MNVNPIELHQLIIEDLKQQNSILSEQRSTQVAINKLALKRIEELQGTVAQLELKVKNLEEELGKSSKK NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93161.1; B4U62_22145 0.916588270 0.194394543 -1.308231729 0.233840784 0.218605414 -0.040158076 -0.651969197 0.010769904 0.000000000 -0.021105562 -0.311583112
3 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93241.1 B4U62_22575 82,947 83,222 + 276 91 hypothetical protein MLTKQETNEKESNLVFGNLKLINQSSTICYNKDNQSNLKVIIMKQYTADEMLKLIEELPEEEKKKVLDKVYDEYFLGGGAKRYESVNGEAK NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93241.1; B4U62_22575 -1.601367535 2.457642770 2.476576701 2.922962979 2.599796075 0.929534409 0.000000000 -0.497675528 -1.974813480 -0.503437457 -4.303470105
4 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93200.1 B4U62_22365 44,320 44,559 + 240 79 hypothetical protein MKNPYKVGDKAIIIRQFCGHEFEIGEIVTILHDAGHSDFFQASDGKNTWYVSINEPYPYELIKKKIQEEFKKTPAKFIN NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93200.1; B4U62_22365 1.227131733 -0.968993182 -0.848729368 -0.072287114 -0.055813624 0.212239514 -0.357417290 0.321313367 0.000000000 0.713361731 0.713361731
5 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93217.1 B4U62_22455 61,569 62,030 + 462 153 hypothetical protein MTNSTTCVVAPTPEFVKPKIIILEGVDRSGKSTLQHAINKATCYKHIVVDRGPIGFKTYCDLFSRDPQLWDNYDDLEKHLAKMEDVLVIYLDCDTKVLIDRCIQTGHEILDYTLHKHFYKFYFDKSPMKKIIVDTTYKTPEEIANDLVKEGVL NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93217.1; B4U62_22455 -0.754510786 0.920001601 -0.002050861 0.117901367 0.454396954 0.622914418 -0.188431340 0.000000000 0.087331872 -1.546878115 -1.546878115
6 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93239.1 B4U62_22565 82,067 82,288 + 222 73 hypothetical protein MDFILQISKKKSVTVWKKIGTLTFPFLFLIQSAFESVCDYFELSTKSDVMWMIIFVMFCVFTWMFCIVINMFN NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93239.1; B4U62_22565 0.927732081 2.139474342 -0.585873204 2.439009752 1.886100261 0.801782065 0.000000000 -0.476907139 -0.932993304 -0.731706445 -1.496115183
7 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93183.1 B4U62_22275 32,712 33,011 + 300 99 hypothetical protein MFEDFIITNHVIQRYEQRVGECRKNIESRIKRDVRNLNIKQIVNNGNVRHIFTRNSKEFIFVKERNRWILTTVIKRSRNNNHEAIEKRKRMAKRMAACV NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93183.1; B4U62_22275 1.806941444 -0.781500894 -0.491312078 0.039108660 0.232240418 0.635185845 0.000000000 -0.683839422 0.076087401 -0.476811623 -0.476811623
8 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93246.1 B4U62_22350 42,749 43,276 + 528 175 hypothetical protein MKNDLPTGEYKVKGFTVGWGNEVIELKNTIVGAELAEAFMDLYPVGSTGQLNFKINNYAVVDEVKESNQVSHGFGSTEKAEARQVTNYVNNIEVIGGEIPYFGDKAYTEEEIETALQIRKLKLQELSQPAEDTPPSGFGSNGNDLPPGSLPTGMEPPQDDNPFSDAPNTDDMPDF NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93246.1; B4U62_22350 0.735893364 -0.536013209 -0.086340877 1.276854647 1.138472262 1.579385538 0.368575058 0.000000000 -1.673864116 -1.201800468 -3.966209206
9 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93247.1 B4U62_22450 61,065 61,376 + 312 103 hypothetical protein MFRHPKVRNELKIGMTTRPWQERYAEANMNTYTSRDLEVVATFPCKDGKAVERLIHSQFEEYRLPPKTGQTKQPEWFEFPEDKVDEVITRIEKFMKSIDLLAI NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93247.1; B4U62_22450 -1.851995598 1.113049426 0.000000000 0.375973539 0.381288709 0.065727174 0.172492015 -0.544167938 -2.613348516 -1.639940563 -3.473178173
10 12 Bacillus_subtilis_subsp_subtilis_str_NCIB_3610_node : Bacillus_subtilis_subsp_subtilis_str_ncib_3610 AQZ93211.1 B4U62_22420 55,561 55,764 + 204 67 hypothetical protein MRSVIKIEIDRPLNSEEIEYVNKLSAEEKEEQIKRMNYAIKDMLELEGIHPQFLRITNKIVGESNED NA NA NA NA NA NA NA NA NA NA NA NA NA AQZ93211.1; B4U62_22420 1.380174475 -0.347411582 -1.674720523 -0.187985964 0.214388669 0.925928470 0.583683841 0.281711032 -0.085717971 -0.042222461 0.000000000

Contact

Domazet-Lošo Research Group

Macroevolution Research. Our lab focuses on macro-evolutionary patterns across the tree of life.
Ruđer Bošković Institute

Division of Molecular Biology
Laboratory of Evolutionary Genetics
wing 5 / rooms 109-111

Biljenička cesta 54
HR-10000 Zagreb
Croatia
linkedin facebook pinterest youtube rss twitter instagram facebook-blank rss-blank linkedin-blank pinterest youtube twitter instagram